PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c23_7530V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 462aa    MW: 49782.3 Da    PI: 7.7352
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c23_7530V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.2e-181964147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                       +g+W++eEd  l ++v+++G ++W++I++ ++ gR++k+c++rw + 
  Pp3c23_7530V3.2.p 19 KGPWSPEEDAALQQLVEKYGARNWSLISKGIP-GRSGKSCRLRWCNQ 64
                       79******************************.***********985 PP

2Myb_DNA-binding57.53e-1873115347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        ++Tt Ede ++ a+ q+G++ W+tIar ++ gRt++ +k++w++ 
  Pp3c23_7530V3.2.p  73 PFTTAEDETIIAAHSQHGNK-WATIARLLP-GRTDNAIKNHWNST 115
                        89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.4311469IPR017930Myb domain
SuperFamilySSF466898.44E-3216112IPR009057Homeodomain-like
SMARTSM007174.8E-171867IPR001005SANT/Myb domain
PfamPF002496.4E-181964IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-252072IPR009057Homeodomain-like
CDDcd001677.77E-162163No hitNo description
SMARTSM007171.4E-1470118IPR001005SANT/Myb domain
PROSITE profilePS5129421.35770120IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.4E-2373119IPR009057Homeodomain-like
PfamPF002492.0E-1473115IPR001005SANT/Myb domain
CDDcd001671.44E-1173116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0010200Biological Processresponse to chitin
GO:0048527Biological Processlateral root development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MSMGGPMRCS VLEEFDRIKG PWSPEEDAAL QQLVEKYGAR NWSLISKGIP GRSGKSCRLR  60
WCNQLSPQVQ HRPFTTAEDE TIIAAHSQHG NKWATIARLL PGRTDNAIKN HWNSTLRRRH  120
TVERPSRSEC AEQQFNHAGR VSHVDEDDGG SVDGWKRSNK EISSDGSVQE KGGWEVDSHR  180
MKRLHVESES PRELSATFMH APQVFRPIPR SSAFSSFSPN GVFTPPTSEP SETSEVTDPP  240
TSLSLSLPGS SPARKEQSSS EDSLLARQVS IASHVPGSQS QLVSPDLHGQ GRWEGGISVD  300
QKFPDRFPTP TFSVPTASSP TQLVGSQLSA LSRAAPTGYN LSGNPPTAEM MSAAVRSAVA  360
QAFGPVLQAQ GVQGTQTWDP PRPPTLSHGL DAAVNAGLVA LMRDMVANEV QKYMAAVHSS  420
SCAPYFPSFG PDHASVGSHI KYSGQSDFLG SMATSSPRKA G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-38161194107B-MYB
1mse_C9e-38181193104C-Myb DNA-Binding Domain
1msf_C9e-38181193104C-Myb DNA-Binding Domain
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00632PBMTransfer from PK28565.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S10_267V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.14e-58myb domain protein 70